Placeholder image of a protein
Icon representing a puzzle

1596: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since over 7 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
November 06, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we are modeling them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,902
  2. Avatar for Contenders 2. Contenders 70 pts. 9,833
  3. Avatar for Beta Folders 3. Beta Folders 47 pts. 9,803
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 30 pts. 9,780
  5. Avatar for Gargleblasters 5. Gargleblasters 19 pts. 9,777
  6. Avatar for Void Crushers 6. Void Crushers 11 pts. 9,769
  7. Avatar for Go Science 7. Go Science 7 pts. 9,687
  8. Avatar for Marvin's bunch 8. Marvin's bunch 4 pts. 9,668
  9. Avatar for Deleted group 9. Deleted group pts. 9,588
  10. Avatar for HMT heritage 10. HMT heritage 1 pt. 9,393

  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 9,867
  2. Avatar for Mark- 2. Mark- Lv 1 97 pts. 9,833
  3. Avatar for retiredmichael 3. retiredmichael Lv 1 93 pts. 9,800
  4. Avatar for nicobul 4. nicobul Lv 1 90 pts. 9,780
  5. Avatar for actiasluna 5. actiasluna Lv 1 87 pts. 9,777
  6. Avatar for LociOiling 6. LociOiling Lv 1 84 pts. 9,773
  7. Avatar for Timo van der Laan 7. Timo van der Laan Lv 1 81 pts. 9,769
  8. Avatar for johnmitch 8. johnmitch Lv 1 78 pts. 9,760
  9. Avatar for Blipperman 9. Blipperman Lv 1 75 pts. 9,745
  10. Avatar for jobo0502 10. jobo0502 Lv 1 72 pts. 9,713

Comments