Placeholder image of a protein
Icon representing a puzzle

1596: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since over 7 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
November 06, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we are modeling them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups


  1. Avatar for Russian team 11. Russian team 1 pt. 9,070
  2. Avatar for freefolder 12. freefolder 1 pt. 8,837
  3. Avatar for Minions of TWIS 13. Minions of TWIS 1 pt. 8,765
  4. Avatar for Czech National Team 14. Czech National Team 1 pt. 8,735
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 8,404

  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 9,867
  2. Avatar for Mark- 2. Mark- Lv 1 97 pts. 9,833
  3. Avatar for retiredmichael 3. retiredmichael Lv 1 93 pts. 9,800
  4. Avatar for nicobul 4. nicobul Lv 1 90 pts. 9,780
  5. Avatar for actiasluna 5. actiasluna Lv 1 87 pts. 9,777
  6. Avatar for LociOiling 6. LociOiling Lv 1 84 pts. 9,773
  7. Avatar for Timo van der Laan 7. Timo van der Laan Lv 1 81 pts. 9,769
  8. Avatar for johnmitch 8. johnmitch Lv 1 78 pts. 9,760
  9. Avatar for Blipperman 9. Blipperman Lv 1 75 pts. 9,745
  10. Avatar for jobo0502 10. jobo0502 Lv 1 72 pts. 9,713

Comments