Placeholder image of a protein
Icon representing a puzzle

1596: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since over 7 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
November 06, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we are modeling them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,902
  2. Avatar for Contenders 2. Contenders 70 pts. 9,833
  3. Avatar for Beta Folders 3. Beta Folders 47 pts. 9,803
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 30 pts. 9,780
  5. Avatar for Gargleblasters 5. Gargleblasters 19 pts. 9,777
  6. Avatar for Void Crushers 6. Void Crushers 11 pts. 9,769
  7. Avatar for Go Science 7. Go Science 7 pts. 9,687
  8. Avatar for Marvin's bunch 8. Marvin's bunch 4 pts. 9,668
  9. Avatar for Deleted group 9. Deleted group pts. 9,588
  10. Avatar for HMT heritage 10. HMT heritage 1 pt. 9,393

  1. Avatar for freethought78 21. freethought78 Lv 1 46 pts. 9,588
  2. Avatar for katling 22. katling Lv 1 44 pts. 9,580
  3. Avatar for silent gene 23. silent gene Lv 1 42 pts. 9,578
  4. Avatar for NinjaGreg 24. NinjaGreg Lv 1 41 pts. 9,551
  5. Avatar for smilingone 25. smilingone Lv 1 39 pts. 9,543
  6. Avatar for Anfinsen_slept_here 26. Anfinsen_slept_here Lv 1 37 pts. 9,536
  7. Avatar for gdnskye 27. gdnskye Lv 1 36 pts. 9,515
  8. Avatar for zid 28. zid Lv 1 34 pts. 9,508
  9. Avatar for Vinara 29. Vinara Lv 1 33 pts. 9,478
  10. Avatar for diamonddays 30. diamonddays Lv 1 31 pts. 9,472

Comments