Placeholder image of a protein
Icon representing a puzzle

1596: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since over 7 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
November 06, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we are modeling them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,902
  2. Avatar for Contenders 2. Contenders 70 pts. 9,833
  3. Avatar for Beta Folders 3. Beta Folders 47 pts. 9,803
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 30 pts. 9,780
  5. Avatar for Gargleblasters 5. Gargleblasters 19 pts. 9,777
  6. Avatar for Void Crushers 6. Void Crushers 11 pts. 9,769
  7. Avatar for Go Science 7. Go Science 7 pts. 9,687
  8. Avatar for Marvin's bunch 8. Marvin's bunch 4 pts. 9,668
  9. Avatar for Deleted group 9. Deleted group pts. 9,588
  10. Avatar for HMT heritage 10. HMT heritage 1 pt. 9,393

  1. Avatar for georged 71. georged Lv 1 3 pts. 8,937
  2. Avatar for altejoh 72. altejoh Lv 1 3 pts. 8,893
  3. Avatar for Wojcimierz 73. Wojcimierz Lv 1 3 pts. 8,890
  4. Avatar for Sigonith 74. Sigonith Lv 1 3 pts. 8,888
  5. Avatar for pfirth 75. pfirth Lv 1 3 pts. 8,885
  6. Avatar for dpmattingly 76. dpmattingly Lv 1 2 pts. 8,872
  7. Avatar for rinze 77. rinze Lv 1 2 pts. 8,862
  8. Avatar for alcor29 78. alcor29 Lv 1 2 pts. 8,846
  9. Avatar for Altercomp 79. Altercomp Lv 1 2 pts. 8,837
  10. Avatar for ManVsYard 80. ManVsYard Lv 1 2 pts. 8,821

Comments