Placeholder image of a protein
Icon representing a puzzle

1598: Cryo-EM Freestyle with Density

Closed since over 7 years ago

Overall Prediction Electron Density

Summary


Created
November 12, 2018
Expires
Max points
100
Description

This protein is another part of the same protein complex with multiple subunits from Puzzle 1554 and Puzzle 1588, which has been the target of cryo-EM experiments. We are giving you an extended chain to start with, so good luck!

Top groups


  1. Avatar for Czech National Team 11. Czech National Team 2 pts. 9,934
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 9,885
  3. Avatar for freefolder 13. freefolder 1 pt. 9,530
  4. Avatar for cit 14. cit 1 pt. 9,063
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 7,985
  6. Avatar for Team South Africa 16. Team South Africa 1 pt. 4,015
  7. Avatar for Deleted group 18. Deleted group pts. 0
  8. Avatar for DSN @ Home 19. DSN @ Home 1 pt. 0

  1. Avatar for grogar7
    1. grogar7 Lv 1
    100 pts. 18,569
  2. Avatar for Susume 2. Susume Lv 1 98 pts. 18,529
  3. Avatar for retiredmichael 3. retiredmichael Lv 1 95 pts. 18,509
  4. Avatar for LociOiling 4. LociOiling Lv 1 92 pts. 18,452
  5. Avatar for Bruno Kestemont 5. Bruno Kestemont Lv 1 89 pts. 18,377
  6. Avatar for fiendish_ghoul 6. fiendish_ghoul Lv 1 87 pts. 18,327
  7. Avatar for drumpeter18yrs9yrs 7. drumpeter18yrs9yrs Lv 1 84 pts. 18,307
  8. Avatar for bertro 8. bertro Lv 1 82 pts. 18,286
  9. Avatar for guineapig 9. guineapig Lv 1 79 pts. 18,260
  10. Avatar for Anfinsen_slept_here 10. Anfinsen_slept_here Lv 1 77 pts. 18,212

Comments


beta_helix Staff Lv 1

MSTPAVSHRFLVNFLFNNIPNPFDIAFQRISGLSRTLEVSQHREGGENVRNLWLAEQVNHGSL
VLERGVMNASPLTLQFDRVLRRESTQWANVVIMLLNELSLPVTTWTLSHALPVRWQMGDLDAG
SNQVLINTLELRYQDMRMLGVKL

beta_helix Staff Lv 1

Thank you both for the feedback, we've extended this one by another week.
Sadly we won't be able to extend it for 6 months, though! :-)

frood66 Lv 1

2 weeks for a very clear ED is a joke - it only plays to those that have big machines and rely on script work. If I can play this with handwork and have no issues - why are those with big machines given such a ridiculous amount of time to catch up?

frood66 Lv 1

but U can run a fast machine 24 hrs a day on multiple puzzles regardless - I cannot…be fair michael. U know what I mean.

retiredmichael Lv 1

there isn't a script for electron density, right now i have 1/2 an hour before I have to pick up my granddaughter at school. then its cook dinner for the family. I have a bit of time each morning after I drop her off and then its laundry, shopping and the garden etc.

I agree with you on revisits, and most of the other puzzles. just not ed