Placeholder image of a protein
Icon representing a puzzle

1598: Cryo-EM Freestyle with Density

Closed since over 7 years ago

Overall Prediction Electron Density

Summary

Created
November 12, 2018
Expires
Max points
100
Description

This protein is another part of the same protein complex with multiple subunits from Puzzle 1554 and Puzzle 1588, which has been the target of cryo-EM experiments. We are giving you an extended chain to start with, so good luck!

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 18,575
  2. Avatar for Beta Folders 2. Beta Folders 76 pts. 18,531
  3. Avatar for Go Science 3. Go Science 56 pts. 18,377
  4. Avatar for Marvin's bunch 4. Marvin's bunch 41 pts. 18,306
  5. Avatar for Gargleblasters 5. Gargleblasters 29 pts. 15,926
  6. Avatar for Void Crushers 6. Void Crushers 20 pts. 14,746
  7. Avatar for Contenders 7. Contenders 14 pts. 13,372
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 9 pts. 12,343
  9. Avatar for Russian team 9. Russian team 6 pts. 12,185
  10. Avatar for Deleted group 10. Deleted group pts. 11,046
  1. Avatar for grogar7
    1. grogar7 Lv 1
    100 pts. 18,569
  2. Avatar for Susume 2. Susume Lv 1 98 pts. 18,529
  3. Avatar for retiredmichael 3. retiredmichael Lv 1 95 pts. 18,509
  4. Avatar for LociOiling 4. LociOiling Lv 1 92 pts. 18,452
  5. Avatar for Bruno Kestemont 5. Bruno Kestemont Lv 1 89 pts. 18,377
  6. Avatar for fiendish_ghoul 6. fiendish_ghoul Lv 1 87 pts. 18,327
  7. Avatar for drumpeter18yrs9yrs 7. drumpeter18yrs9yrs Lv 1 84 pts. 18,307
  8. Avatar for bertro 8. bertro Lv 1 82 pts. 18,286
  9. Avatar for guineapig 9. guineapig Lv 1 79 pts. 18,260
  10. Avatar for Anfinsen_slept_here 10. Anfinsen_slept_here Lv 1 77 pts. 18,212

Comments

beta_helix Staff Lv 1

MSTPAVSHRFLVNFLFNNIPNPFDIAFQRISGLSRTLEVSQHREGGENVRNLWLAEQVNHGSL
VLERGVMNASPLTLQFDRVLRRESTQWANVVIMLLNELSLPVTTWTLSHALPVRWQMGDLDAG
SNQVLINTLELRYQDMRMLGVKL

beta_helix Staff Lv 1

Thank you both for the feedback, we've extended this one by another week.
Sadly we won't be able to extend it for 6 months, though! :-)

frood66 Lv 1

2 weeks for a very clear ED is a joke - it only plays to those that have big machines and rely on script work. If I can play this with handwork and have no issues - why are those with big machines given such a ridiculous amount of time to catch up?

frood66 Lv 1

but U can run a fast machine 24 hrs a day on multiple puzzles regardless - I cannot…be fair michael. U know what I mean.

retiredmichael Lv 1

there isn't a script for electron density, right now i have 1/2 an hour before I have to pick up my granddaughter at school. then its cook dinner for the family. I have a bit of time each morning after I drop her off and then its laundry, shopping and the garden etc.

I agree with you on revisits, and most of the other puzzles. just not ed