beta_helix Staff Lv 1
MSTPAVSHRFLVNFLFNNIPNPFDIAFQRISGLSRTLEVSQHREGGENVRNLWLAEQVNHGSL
VLERGVMNASPLTLQFDRVLRRESTQWANVVIMLLNELSLPVTTWTLSHALPVRWQMGDLDAG
SNQVLINTLELRYQDMRMLGVKL
Closed since over 7 years ago
Overall Overall Prediction Prediction Electron Density Electron DensityThis protein is another part of the same protein complex with multiple subunits from Puzzle 1554 and Puzzle 1588, which has been the target of cryo-EM experiments. We are giving you an extended chain to start with, so good luck!
MSTPAVSHRFLVNFLFNNIPNPFDIAFQRISGLSRTLEVSQHREGGENVRNLWLAEQVNHGSL
VLERGVMNASPLTLQFDRVLRRESTQWANVVIMLLNELSLPVTTWTLSHALPVRWQMGDLDAG
SNQVLINTLELRYQDMRMLGVKL
more time, maybe 6 months
2 weeks
at least 2 weeks
Thank you both for the feedback, we've extended this one by another week.
Sadly we won't be able to extend it for 6 months, though! :-)
this needs no more time I have spent just 10 hours on this….no more time is needed.
2 weeks for a very clear ED is a joke - it only plays to those that have big machines and rely on script work. If I can play this with handwork and have no issues - why are those with big machines given such a ridiculous amount of time to catch up?
i have 2 hours a day to work on foldit, 10 hours the first day—not possible
but U can run a fast machine 24 hrs a day on multiple puzzles regardless - I cannot…be fair michael. U know what I mean.
there isn't a script for electron density, right now i have 1/2 an hour before I have to pick up my granddaughter at school. then its cook dinner for the family. I have a bit of time each morning after I drop her off and then its laundry, shopping and the garden etc.
I agree with you on revisits, and most of the other puzzles. just not ed