Placeholder image of a protein
Icon representing a puzzle

1599: Revisiting Puzzle 86: Nematode

Closed since over 7 years ago

Novice Overall Prediction

Summary

Created
November 13, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups

  1. Avatar for Trinity Biology 11. Trinity Biology 4 pts. 9,033
  2. Avatar for Czech National Team 12. Czech National Team 2 pts. 8,704
  3. Avatar for freefolder 13. freefolder 2 pts. 8,649
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 8,605
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 8,344
  6. Avatar for Italiani Al Lavoro 16. Italiani Al Lavoro 1 pt. 7,781
  7. Avatar for Eὕρηκα! Heureka! 17. Eὕρηκα! Heureka! 1 pt. 7,591
  8. Avatar for cit 18. cit 1 pt. 7,323
  9. Avatar for test_group1 19. test_group1 1 pt. 4,094
  10. Avatar for AST Biology 20. AST Biology 1 pt. 4,094
  1. Avatar for test_account1 141. test_account1 Lv 1 1 pt. 4,094
  2. Avatar for josh04 142. josh04 Lv 1 1 pt. 4,094
  3. Avatar for Bletchley Park 143. Bletchley Park Lv 1 1 pt. 4,094
  4. Avatar for Museka 144. Museka Lv 1 1 pt. 4,094
  5. Avatar for Hollinas 145. Hollinas Lv 1 1 pt. 4,094
  6. Avatar for foldit_champion_mlg 146. foldit_champion_mlg Lv 1 1 pt. 4,094
  7. Avatar for mrice17 147. mrice17 Lv 1 1 pt. 4,094
  8. Avatar for sofiaestevez 148. sofiaestevez Lv 1 1 pt. 4,094
  9. Avatar for jflat06 149. jflat06 Lv 1 1 pt. 4,094
  10. Avatar for Reuben_Allen 150. Reuben_Allen Lv 1 1 pt. 4,094

Comments