Placeholder image of a protein
Icon representing a puzzle

1599: Revisiting Puzzle 86: Nematode

Closed since over 7 years ago

Novice Overall Prediction

Summary

Created
November 13, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,311
  2. Avatar for Contenders 2. Contenders 78 pts. 11,044
  3. Avatar for Beta Folders 3. Beta Folders 60 pts. 11,022
  4. Avatar for Gargleblasters 4. Gargleblasters 45 pts. 10,992
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 33 pts. 10,854
  6. Avatar for Go Science 6. Go Science 24 pts. 10,812
  7. Avatar for Marvin's bunch 7. Marvin's bunch 17 pts. 10,708
  8. Avatar for Void Crushers 8. Void Crushers 12 pts. 10,668
  9. Avatar for Russian team 9. Russian team 8 pts. 10,153
  10. Avatar for HMT heritage 10. HMT heritage 6 pts. 9,520
  1. Avatar for test_account1 141. test_account1 Lv 1 1 pt. 4,094
  2. Avatar for josh04 142. josh04 Lv 1 1 pt. 4,094
  3. Avatar for Museka 143. Museka Lv 1 1 pt. 4,094
  4. Avatar for Bletchley Park 144. Bletchley Park Lv 1 1 pt. 4,094
  5. Avatar for Hollinas 145. Hollinas Lv 1 1 pt. 4,094
  6. Avatar for foldit_champion_mlg 146. foldit_champion_mlg Lv 1 1 pt. 4,094
  7. Avatar for mrice17 147. mrice17 Lv 1 1 pt. 4,094
  8. Avatar for sofiaestevez 148. sofiaestevez Lv 1 1 pt. 4,094
  9. Avatar for jflat06 149. jflat06 Lv 1 1 pt. 4,094
  10. Avatar for Reuben_Allen 150. Reuben_Allen Lv 1 1 pt. 4,094

Comments