Placeholder image of a protein
Icon representing a puzzle

1599: Revisiting Puzzle 86: Nematode

Closed since over 7 years ago

Novice Overall Prediction

Summary

Created
November 13, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups

  1. Avatar for Window Group 21. Window Group 1 pt. 4,094
  1. Avatar for isaksson 71. isaksson Lv 1 5 pts. 8,972
  2. Avatar for fisherlr777 72. fisherlr777 Lv 1 5 pts. 8,970
  3. Avatar for DoctorSockrates 73. DoctorSockrates Lv 1 5 pts. 8,969
  4. Avatar for cobaltteal 74. cobaltteal Lv 1 4 pts. 8,886
  5. Avatar for RyeSnake 75. RyeSnake Lv 1 4 pts. 8,859
  6. Avatar for ghiggins 76. ghiggins Lv 1 4 pts. 8,716
  7. Avatar for Biosphere 77. Biosphere Lv 1 4 pts. 8,704
  8. Avatar for rezaefar 78. rezaefar Lv 1 3 pts. 8,677
  9. Avatar for dbuske 79. dbuske Lv 1 3 pts. 8,676
  10. Avatar for Altercomp 80. Altercomp Lv 1 3 pts. 8,649

Comments