Placeholder image of a protein
Icon representing a puzzle

1599: Revisiting Puzzle 86: Nematode

Closed since over 7 years ago

Novice Overall Prediction

Summary

Created
November 13, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,311
  2. Avatar for Contenders 2. Contenders 78 pts. 11,044
  3. Avatar for Beta Folders 3. Beta Folders 60 pts. 11,022
  4. Avatar for Gargleblasters 4. Gargleblasters 45 pts. 10,992
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 33 pts. 10,854
  6. Avatar for Go Science 6. Go Science 24 pts. 10,812
  7. Avatar for Marvin's bunch 7. Marvin's bunch 17 pts. 10,708
  8. Avatar for Void Crushers 8. Void Crushers 12 pts. 10,668
  9. Avatar for Russian team 9. Russian team 8 pts. 10,153
  10. Avatar for HMT heritage 10. HMT heritage 6 pts. 9,520
  1. Avatar for isaksson 71. isaksson Lv 1 5 pts. 8,972
  2. Avatar for fisherlr777 72. fisherlr777 Lv 1 5 pts. 8,970
  3. Avatar for DoctorSockrates 73. DoctorSockrates Lv 1 5 pts. 8,969
  4. Avatar for cobaltteal 74. cobaltteal Lv 1 4 pts. 8,886
  5. Avatar for RyeSnake 75. RyeSnake Lv 1 4 pts. 8,859
  6. Avatar for ghiggins 76. ghiggins Lv 1 4 pts. 8,716
  7. Avatar for Biosphere 77. Biosphere Lv 1 4 pts. 8,704
  8. Avatar for rezaefar 78. rezaefar Lv 1 3 pts. 8,677
  9. Avatar for dbuske 79. dbuske Lv 1 3 pts. 8,676
  10. Avatar for Altercomp 80. Altercomp Lv 1 3 pts. 8,649

Comments