Placeholder image of a protein
Icon representing a puzzle

1599: Revisiting Puzzle 86: Nematode

Closed since over 7 years ago

Novice Overall Prediction

Summary


Created
November 13, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 11,311
  2. Avatar for Contenders 2. Contenders 78 pts. 11,044
  3. Avatar for Beta Folders 3. Beta Folders 60 pts. 11,022
  4. Avatar for Gargleblasters 4. Gargleblasters 45 pts. 10,992
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 33 pts. 10,854
  6. Avatar for Go Science 6. Go Science 24 pts. 10,812
  7. Avatar for Marvin's bunch 7. Marvin's bunch 17 pts. 10,708
  8. Avatar for Void Crushers 8. Void Crushers 12 pts. 10,668
  9. Avatar for Russian team 9. Russian team 8 pts. 10,153
  10. Avatar for HMT heritage 10. HMT heritage 6 pts. 9,520

  1. Avatar for ivalnic 121. ivalnic Lv 1 1 pt. 7,474
  2. Avatar for cbwest 122. cbwest Lv 1 1 pt. 7,410
  3. Avatar for Rainy Fall 123. Rainy Fall Lv 1 1 pt. 7,385
  4. Avatar for aesopr13206 124. aesopr13206 Lv 1 1 pt. 7,384
  5. Avatar for devjosh 125. devjosh Lv 1 1 pt. 7,378
  6. Avatar for alcor29 126. alcor29 Lv 1 1 pt. 7,362
  7. Avatar for gchadwick 127. gchadwick Lv 1 1 pt. 7,323
  8. Avatar for DipsyDoodle2016 128. DipsyDoodle2016 Lv 1 1 pt. 7,117
  9. Avatar for shettler 129. shettler Lv 1 1 pt. 7,037
  10. Avatar for Paulo Roque 130. Paulo Roque Lv 1 1 pt. 6,613

Comments