Placeholder image of a protein
Icon representing a puzzle

1599: Revisiting Puzzle 86: Nematode

Closed since over 7 years ago

Novice Overall Prediction

Summary


Created
November 13, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 11,311
  2. Avatar for Contenders 2. Contenders 78 pts. 11,044
  3. Avatar for Beta Folders 3. Beta Folders 60 pts. 11,022
  4. Avatar for Gargleblasters 4. Gargleblasters 45 pts. 10,992
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 33 pts. 10,854
  6. Avatar for Go Science 6. Go Science 24 pts. 10,812
  7. Avatar for Marvin's bunch 7. Marvin's bunch 17 pts. 10,708
  8. Avatar for Void Crushers 8. Void Crushers 12 pts. 10,668
  9. Avatar for Russian team 9. Russian team 8 pts. 10,153
  10. Avatar for HMT heritage 10. HMT heritage 6 pts. 9,520

  1. Avatar for phi16 41. phi16 Lv 1 22 pts. 10,001
  2. Avatar for jausmh 42. jausmh Lv 1 21 pts. 9,962
  3. Avatar for smilingone 43. smilingone Lv 1 20 pts. 9,948
  4. Avatar for frostschutz 44. frostschutz Lv 1 19 pts. 9,906
  5. Avatar for andrewxc 45. andrewxc Lv 1 19 pts. 9,871
  6. Avatar for altejoh 46. altejoh Lv 1 18 pts. 9,855
  7. Avatar for Deleted player 47. Deleted player pts. 9,814
  8. Avatar for Maerlyn138 48. Maerlyn138 Lv 1 16 pts. 9,807
  9. Avatar for pfirth 49. pfirth Lv 1 15 pts. 9,746
  10. Avatar for Merf 50. Merf Lv 1 15 pts. 9,724

Comments