Placeholder image of a protein
Icon representing a puzzle

1603: Unsolved De-novo Freestyle 138

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
November 27, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


MEGEVRGEKIKMGNVEGDAKEWKIKDLGVVGKGVFELNNTKVFIMVDESRQVGLAVFYDEDNNKMRAEVWVEIDHRRNAGVLNGRQVDIKDGHGRVK

Top groups

  1. Avatar for freefolder 11. freefolder 1 pt. 8,828
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 8,419
  3. Avatar for DSN @ Home 13. DSN @ Home 1 pt. 5,664
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 4,490
  5. Avatar for incognito group 15. incognito group 1 pt. 0
  1. Avatar for icaru-5 111. icaru-5 Lv 1 1 pt. 6,876
  2. Avatar for RelativityIH 112. RelativityIH Lv 1 1 pt. 6,696
  3. Avatar for Sydefecks 113. Sydefecks Lv 1 1 pt. 6,397
  4. Avatar for Arne Heessels 114. Arne Heessels Lv 1 1 pt. 6,302
  5. Avatar for justjustin 115. justjustin Lv 1 1 pt. 6,181
  6. Avatar for MAP-Kinase-Kinase-Kinase 116. MAP-Kinase-Kinase-Kinase Lv 1 1 pt. 5,742
  7. Avatar for aspadistra 117. aspadistra Lv 1 1 pt. 5,664
  8. Avatar for Merrimoose 118. Merrimoose Lv 1 1 pt. 5,546
  9. Avatar for momadoc 119. momadoc Lv 1 1 pt. 4,963
  10. Avatar for Leticia Regina 120. Leticia Regina Lv 1 1 pt. 4,834

Comments