Placeholder image of a protein
Icon representing a puzzle

1603: Unsolved De-novo Freestyle 138

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
November 27, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


MEGEVRGEKIKMGNVEGDAKEWKIKDLGVVGKGVFELNNTKVFIMVDESRQVGLAVFYDEDNNKMRAEVWVEIDHRRNAGVLNGRQVDIKDGHGRVK

Top groups

  1. Avatar for freefolder 11. freefolder 1 pt. 8,828
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 8,419
  3. Avatar for DSN @ Home 13. DSN @ Home 1 pt. 5,664
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 4,490
  5. Avatar for incognito group 15. incognito group 1 pt. 0
  1. Avatar for drjr 121. drjr Lv 1 1 pt. 4,647
  2. Avatar for Franek 122. Franek Lv 1 1 pt. 4,612
  3. Avatar for lamoille 123. lamoille Lv 1 1 pt. 4,530
  4. Avatar for alyssa_d 124. alyssa_d Lv 1 1 pt. 4,490
  5. Avatar for citric acid 125. citric acid Lv 1 1 pt. 4,487
  6. Avatar for Aminal88 126. Aminal88 Lv 1 1 pt. 4,341
  7. Avatar for 01010011111 127. 01010011111 Lv 1 1 pt. 3,529
  8. Avatar for Acenes 128. Acenes Lv 1 1 pt. 1,577
  9. Avatar for gdnskye 129. gdnskye Lv 1 1 pt. 0
  10. Avatar for albatroskalnaes 130. albatroskalnaes Lv 1 1 pt. 0

Comments