Placeholder image of a protein
Icon representing a puzzle

1603: Unsolved De-novo Freestyle 138

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
November 27, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


MEGEVRGEKIKMGNVEGDAKEWKIKDLGVVGKGVFELNNTKVFIMVDESRQVGLAVFYDEDNNKMRAEVWVEIDHRRNAGVLNGRQVDIKDGHGRVK

Top groups

  1. Avatar for freefolder 11. freefolder 1 pt. 8,828
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 8,419
  3. Avatar for DSN @ Home 13. DSN @ Home 1 pt. 5,664
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 4,490
  5. Avatar for incognito group 15. incognito group 1 pt. 0
  1. Avatar for Bruno Kestemont 11. Bruno Kestemont Lv 1 69 pts. 10,106
  2. Avatar for Galaxie 12. Galaxie Lv 1 66 pts. 10,070
  3. Avatar for retiredmichael 13. retiredmichael Lv 1 63 pts. 10,038
  4. Avatar for smilingone 14. smilingone Lv 1 61 pts. 10,027
  5. Avatar for frood66 15. frood66 Lv 1 58 pts. 9,973
  6. Avatar for jobo0502 16. jobo0502 Lv 1 56 pts. 9,968
  7. Avatar for Timo van der Laan 17. Timo van der Laan Lv 1 54 pts. 9,942
  8. Avatar for georg137 18. georg137 Lv 1 52 pts. 9,920
  9. Avatar for Blipperman 19. Blipperman Lv 1 49 pts. 9,903
  10. Avatar for christioanchauvin 20. christioanchauvin Lv 1 47 pts. 9,901

Comments