Placeholder image of a protein
Icon representing a puzzle

1603: Unsolved De-novo Freestyle 138

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
November 27, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


MEGEVRGEKIKMGNVEGDAKEWKIKDLGVVGKGVFELNNTKVFIMVDESRQVGLAVFYDEDNNKMRAEVWVEIDHRRNAGVLNGRQVDIKDGHGRVK

Top groups

  1. Avatar for freefolder 11. freefolder 1 pt. 8,828
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 8,419
  3. Avatar for DSN @ Home 13. DSN @ Home 1 pt. 5,664
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 4,490
  5. Avatar for incognito group 15. incognito group 1 pt. 0
  1. Avatar for dpmattingly 51. dpmattingly Lv 1 10 pts. 9,560
  2. Avatar for bertro 52. bertro Lv 1 10 pts. 9,543
  3. Avatar for Anfinsen_slept_here 53. Anfinsen_slept_here Lv 1 9 pts. 9,538
  4. Avatar for nicobul 54. nicobul Lv 1 9 pts. 9,472
  5. Avatar for tarimo 55. tarimo Lv 1 8 pts. 9,465
  6. Avatar for alwen 56. alwen Lv 1 8 pts. 9,324
  7. Avatar for mnucer 57. mnucer Lv 1 7 pts. 9,317
  8. Avatar for Maerlyn138 58. Maerlyn138 Lv 1 7 pts. 9,289
  9. Avatar for manu8170 59. manu8170 Lv 1 7 pts. 9,287
  10. Avatar for Merf 60. Merf Lv 1 6 pts. 9,266

Comments