Placeholder image of a protein
Icon representing a puzzle

1611: Revisiting Puzzle 90: Heliomicin

Closed since over 7 years ago

Novice Novice Overall Overall Prediction Prediction

Summary

Created
December 19, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 4 pts. 9,548
  2. Avatar for Hold My Beer 12. Hold My Beer 3 pts. 9,137
  3. Avatar for Kotocycle 13. Kotocycle 2 pts. 9,039
  4. Avatar for DW 2020 14. DW 2020 1 pt. 8,676
  5. Avatar for BCC 15. BCC 1 pt. 8,622
  6. Avatar for Czech National Team 16. Czech National Team 1 pt. 8,617
  7. Avatar for FoldIt@Poland 17. FoldIt@Poland 1 pt. 8,508
  8. Avatar for Eὕρηκα! Heureka! 18. Eὕρηκα! Heureka! 1 pt. 8,291
  9. Avatar for Dutch Power Cows 19. Dutch Power Cows 1 pt. 8,283
  10. Avatar for freefolder 20. freefolder 1 pt. 8,231
  1. Avatar for alwan2018 101. alwan2018 Lv 1 1 pt. 8,659
  2. Avatar for JasperD 102. JasperD Lv 1 1 pt. 8,638
  3. Avatar for dizzywings 103. dizzywings Lv 1 1 pt. 8,634
  4. Avatar for frezae 104. frezae Lv 1 1 pt. 8,622
  5. Avatar for Biosphere 105. Biosphere Lv 1 1 pt. 8,617
  6. Avatar for PlagueRat 106. PlagueRat Lv 1 1 pt. 8,603
  7. Avatar for GUANINJIN 107. GUANINJIN Lv 1 1 pt. 8,585
  8. Avatar for dimadeg 108. dimadeg Lv 1 1 pt. 8,572
  9. Avatar for ugugu 109. ugugu Lv 1 1 pt. 8,561
  10. Avatar for Amphimixus 110. Amphimixus Lv 1 1 pt. 8,558

Comments