Placeholder image of a protein
Icon representing a puzzle

1611: Revisiting Puzzle 90: Heliomicin

Closed since over 7 years ago

Novice Overall Prediction

Summary

Created
December 19, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 4 pts. 9,548
  2. Avatar for Hold My Beer 12. Hold My Beer 3 pts. 9,137
  3. Avatar for Kotocycle 13. Kotocycle 2 pts. 9,039
  4. Avatar for DW 2020 14. DW 2020 1 pt. 8,676
  5. Avatar for BCC 15. BCC 1 pt. 8,622
  6. Avatar for Czech National Team 16. Czech National Team 1 pt. 8,617
  7. Avatar for FoldIt@Poland 17. FoldIt@Poland 1 pt. 8,508
  8. Avatar for Eὕρηκα! Heureka! 18. Eὕρηκα! Heureka! 1 pt. 8,291
  9. Avatar for Dutch Power Cows 19. Dutch Power Cows 1 pt. 8,283
  10. Avatar for freefolder 20. freefolder 1 pt. 8,231
  1. Avatar for christioanchauvin 31. christioanchauvin Lv 1 35 pts. 9,534
  2. Avatar for Deleted player 32. Deleted player 34 pts. 9,534
  3. Avatar for guineapig 33. guineapig Lv 1 32 pts. 9,530
  4. Avatar for Bletchley Park 34. Bletchley Park Lv 1 31 pts. 9,527
  5. Avatar for robgee 35. robgee Lv 1 30 pts. 9,509
  6. Avatar for altejoh 36. altejoh Lv 1 29 pts. 9,505
  7. Avatar for aznarog 37. aznarog Lv 1 28 pts. 9,491
  8. Avatar for diamonddays 38. diamonddays Lv 1 27 pts. 9,488
  9. Avatar for isaksson 39. isaksson Lv 1 26 pts. 9,488
  10. Avatar for Vinara 40. Vinara Lv 1 24 pts. 9,484

Comments