Placeholder image of a protein
Icon representing a puzzle

1611: Revisiting Puzzle 90: Heliomicin

Closed since over 7 years ago

Novice Overall Prediction

Summary

Created
December 19, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 4 pts. 9,548
  2. Avatar for Hold My Beer 12. Hold My Beer 3 pts. 9,137
  3. Avatar for Kotocycle 13. Kotocycle 2 pts. 9,039
  4. Avatar for DW 2020 14. DW 2020 1 pt. 8,676
  5. Avatar for BCC 15. BCC 1 pt. 8,622
  6. Avatar for Czech National Team 16. Czech National Team 1 pt. 8,617
  7. Avatar for FoldIt@Poland 17. FoldIt@Poland 1 pt. 8,508
  8. Avatar for Eὕρηκα! Heureka! 18. Eὕρηκα! Heureka! 1 pt. 8,291
  9. Avatar for Dutch Power Cows 19. Dutch Power Cows 1 pt. 8,283
  10. Avatar for freefolder 20. freefolder 1 pt. 8,231
  1. Avatar for Idiotboy 41. Idiotboy Lv 1 23 pts. 9,483
  2. Avatar for Anfinsen_slept_here 42. Anfinsen_slept_here Lv 1 23 pts. 9,472
  3. Avatar for gdnskye 43. gdnskye Lv 1 22 pts. 9,470
  4. Avatar for teraflop 44. teraflop Lv 1 21 pts. 9,469
  5. Avatar for MicElephant 45. MicElephant Lv 1 20 pts. 9,441
  6. Avatar for WBarme1234 46. WBarme1234 Lv 1 19 pts. 9,439
  7. Avatar for Deleted player 47. Deleted player pts. 9,431
  8. Avatar for smilingone 48. smilingone Lv 1 17 pts. 9,414
  9. Avatar for spdenne 49. spdenne Lv 1 17 pts. 9,387
  10. Avatar for Wojcimierz 50. Wojcimierz Lv 1 16 pts. 9,383

Comments