Placeholder image of a protein
Icon representing a puzzle

1611: Revisiting Puzzle 90: Heliomicin

Closed since about 7 years ago

Novice Overall Prediction

Summary


Created
December 19, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups


  1. Avatar for SETIKAH@KOREA 21. SETIKAH@KOREA 1 pt. 8,050
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 4,945

  1. Avatar for Aubade01 11. Aubade01 Lv 1 72 pts. 9,705
  2. Avatar for Mark- 12. Mark- Lv 1 70 pts. 9,702
  3. Avatar for Timo van der Laan 13. Timo van der Laan Lv 1 68 pts. 9,700
  4. Avatar for nicobul 14. nicobul Lv 1 65 pts. 9,697
  5. Avatar for Heinermann 15. Heinermann Lv 1 63 pts. 9,680
  6. Avatar for fiendish_ghoul 16. fiendish_ghoul Lv 1 61 pts. 9,676
  7. Avatar for johnmitch 17. johnmitch Lv 1 59 pts. 9,642
  8. Avatar for phi16 18. phi16 Lv 1 57 pts. 9,637
  9. Avatar for dcrwheeler 19. dcrwheeler Lv 1 55 pts. 9,634
  10. Avatar for YeshuaLives 20. YeshuaLives Lv 1 53 pts. 9,631

Comments