Placeholder image of a protein
Icon representing a puzzle

1611: Revisiting Puzzle 90: Heliomicin

Closed since over 7 years ago

Novice Overall Prediction

Summary

Created
December 19, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups

  1. Avatar for SETIKAH@KOREA 21. SETIKAH@KOREA 1 pt. 8,050
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 4,945
  1. Avatar for lconor 71. lconor Lv 1 6 pts. 9,105
  2. Avatar for toshiue 72. toshiue Lv 1 5 pts. 9,084
  3. Avatar for zid 73. zid Lv 1 5 pts. 9,068
  4. Avatar for KingLear 74. KingLear Lv 1 5 pts. 9,059
  5. Avatar for orily1337 75. orily1337 Lv 1 5 pts. 9,059
  6. Avatar for Merf 76. Merf Lv 1 4 pts. 9,047
  7. Avatar for Ikuso 77. Ikuso Lv 1 4 pts. 9,039
  8. Avatar for jausmh 78. jausmh Lv 1 4 pts. 9,022
  9. Avatar for Arne Heessels 79. Arne Heessels Lv 1 4 pts. 8,984
  10. Avatar for sydlg19 80. sydlg19 Lv 1 4 pts. 8,984

Comments