Placeholder image of a protein
Icon representing a puzzle

1612: Unsolved De-novo Freestyle 139

Closed since about 7 years ago

Intermediate Overall Prediction

Summary

Created
December 20, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


PELEERLKTWLKIWYELMKKLLTWIAKVVSDEEFLKKVYKTMLEMMKEMWKILMEVLKKEEDLKKVIEIAIKFLIDLKRWMEDLKKKILS

Top groups

  1. Avatar for Hold My Beer 11. Hold My Beer 4 pts. 10,445
  2. Avatar for HMT heritage 12. HMT heritage 2 pts. 10,344
  3. Avatar for Deleted group 13. Deleted group pts. 9,224
  4. Avatar for Dutch Power Cows 14. Dutch Power Cows 1 pt. 9,088
  5. Avatar for freefolder 15. freefolder 1 pt. 8,896
  6. Avatar for DW 2020 16. DW 2020 1 pt. 8,572
  7. Avatar for Rechenkraft.net 17. Rechenkraft.net 1 pt. 8,264
  8. Avatar for FoldIt@Poland 18. FoldIt@Poland 1 pt. 6,869
  9. Avatar for Kotocycle 19. Kotocycle 1 pt. 6,829
  10. Avatar for Czech National Team 20. Czech National Team 1 pt. 0
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 11,120
  2. Avatar for Mark- 2. Mark- Lv 1 97 pts. 11,035
  3. Avatar for Timo van der Laan 3. Timo van der Laan Lv 1 94 pts. 10,974
  4. Avatar for retiredmichael 4. retiredmichael Lv 1 91 pts. 10,938
  5. Avatar for christioanchauvin 5. christioanchauvin Lv 1 89 pts. 10,850
  6. Avatar for grogar7 6. grogar7 Lv 1 86 pts. 10,841
  7. Avatar for fiendish_ghoul 7. fiendish_ghoul Lv 1 83 pts. 10,834
  8. Avatar for phi16 8. phi16 Lv 1 80 pts. 10,819
  9. Avatar for crpainter 9. crpainter Lv 1 78 pts. 10,817
  10. Avatar for Vinara 10. Vinara Lv 1 75 pts. 10,790

Comments