Placeholder image of a protein
Icon representing a puzzle

1612: Unsolved De-novo Freestyle 139

Closed since over 7 years ago

Intermediate Overall Prediction

Summary


Created
December 20, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


PELEERLKTWLKIWYELMKKLLTWIAKVVSDEEFLKKVYKTMLEMMKEMWKILMEVLKKEEDLKKVIEIAIKFLIDLKRWMEDLKKKILS

Top groups


  1. Avatar for Beta Folders 100 pts. 11,121
  2. Avatar for Contenders 2. Contenders 78 pts. 11,068
  3. Avatar for Void Crushers 3. Void Crushers 60 pts. 10,974
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 45 pts. 10,907
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 33 pts. 10,850
  6. Avatar for Gargleblasters 6. Gargleblasters 24 pts. 10,720
  7. Avatar for Go Science 7. Go Science 17 pts. 10,672
  8. Avatar for Russian team 8. Russian team 12 pts. 10,643
  9. Avatar for Marvin's bunch 9. Marvin's bunch 8 pts. 10,627
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 6 pts. 10,508

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 11,120
  2. Avatar for Mark- 2. Mark- Lv 1 97 pts. 11,035
  3. Avatar for Timo van der Laan 3. Timo van der Laan Lv 1 94 pts. 10,974
  4. Avatar for retiredmichael 4. retiredmichael Lv 1 91 pts. 10,938
  5. Avatar for christioanchauvin 5. christioanchauvin Lv 1 89 pts. 10,850
  6. Avatar for grogar7 6. grogar7 Lv 1 86 pts. 10,841
  7. Avatar for fiendish_ghoul 7. fiendish_ghoul Lv 1 83 pts. 10,834
  8. Avatar for phi16 8. phi16 Lv 1 80 pts. 10,819
  9. Avatar for crpainter 9. crpainter Lv 1 78 pts. 10,817
  10. Avatar for Vinara 10. Vinara Lv 1 75 pts. 10,790

Comments