Placeholder image of a protein
Icon representing a puzzle

1612: Unsolved De-novo Freestyle 139

Closed since about 7 years ago

Intermediate Overall Prediction

Summary

Created
December 20, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


PELEERLKTWLKIWYELMKKLLTWIAKVVSDEEFLKKVYKTMLEMMKEMWKILMEVLKKEEDLKKVIEIAIKFLIDLKRWMEDLKKKILS

Top groups

  1. Avatar for DSN @ Home 21. DSN @ Home 1 pt. 0
  1. Avatar for matosfran
    1. matosfran Lv 1
    100 pts. 11,121
  2. Avatar for smilingone 2. smilingone Lv 1 84 pts. 11,117
  3. Avatar for LociOiling 3. LociOiling Lv 1 70 pts. 11,117
  4. Avatar for Bletchley Park 4. Bletchley Park Lv 1 58 pts. 11,068
  5. Avatar for reefyrob 5. reefyrob Lv 1 48 pts. 11,059
  6. Avatar for Galaxie 6. Galaxie Lv 1 39 pts. 10,907
  7. Avatar for robgee 7. robgee Lv 1 32 pts. 10,904
  8. Avatar for Deleted player 8. Deleted player pts. 10,873
  9. Avatar for phi16 9. phi16 Lv 1 20 pts. 10,847
  10. Avatar for lamoille 10. lamoille Lv 1 16 pts. 10,826

Comments