Placeholder image of a protein
Icon representing a puzzle

1612: Unsolved De-novo Freestyle 139

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
December 20, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


PELEERLKTWLKIWYELMKKLLTWIAKVVSDEEFLKKVYKTMLEMMKEMWKILMEVLKKEEDLKKVIEIAIKFLIDLKRWMEDLKKKILS

Top groups

  1. Avatar for DSN @ Home 21. DSN @ Home 1 pt. 0
  1. Avatar for Aminal88 41. Aminal88 Lv 1 24 pts. 10,414
  2. Avatar for robgee 42. robgee Lv 1 23 pts. 10,397
  3. Avatar for heather-1 43. heather-1 Lv 1 22 pts. 10,392
  4. Avatar for WBarme1234 44. WBarme1234 Lv 1 21 pts. 10,391
  5. Avatar for manu8170 45. manu8170 Lv 1 20 pts. 10,380
  6. Avatar for Deleted player 46. Deleted player pts. 10,353
  7. Avatar for O Seki To 47. O Seki To Lv 1 19 pts. 10,344
  8. Avatar for Glen B 48. Glen B Lv 1 18 pts. 10,335
  9. Avatar for MicElephant 49. MicElephant Lv 1 17 pts. 10,313
  10. Avatar for Flagg65a 50. Flagg65a Lv 1 16 pts. 10,281

Comments