Placeholder image of a protein
Icon representing a puzzle

1612: Unsolved De-novo Freestyle 139

Closed since over 7 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary

Created
December 20, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


PELEERLKTWLKIWYELMKKLLTWIAKVVSDEEFLKKVYKTMLEMMKEMWKILMEVLKKEEDLKKVIEIAIKFLIDLKRWMEDLKKKILS

Top groups

  1. Avatar for DSN @ Home 21. DSN @ Home 1 pt. 0
  1. Avatar for Mortality 71. Mortality Lv 1 6 pts. 9,724
  2. Avatar for YeshuaLives 72. YeshuaLives Lv 1 6 pts. 9,688
  3. Avatar for rabamino12358 73. rabamino12358 Lv 1 5 pts. 9,678
  4. Avatar for TePie 74. TePie Lv 1 5 pts. 9,532
  5. Avatar for Vincera 75. Vincera Lv 1 5 pts. 9,520
  6. Avatar for Dhalion 76. Dhalion Lv 1 5 pts. 9,454
  7. Avatar for alcor29 77. alcor29 Lv 1 4 pts. 9,431
  8. Avatar for Rastamasta 78. Rastamasta Lv 1 4 pts. 9,406
  9. Avatar for fisherlr777 79. fisherlr777 Lv 1 4 pts. 9,403
  10. Avatar for Arne Heessels 80. Arne Heessels Lv 1 4 pts. 9,367

Comments