Placeholder image of a protein
Icon representing a puzzle

1612: Unsolved De-novo Freestyle 139

Closed since over 7 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
December 20, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


PELEERLKTWLKIWYELMKKLLTWIAKVVSDEEFLKKVYKTMLEMMKEMWKILMEVLKKEEDLKKVIEIAIKFLIDLKRWMEDLKKKILS

Top groups


  1. Avatar for DSN @ Home 21. DSN @ Home 1 pt. 0

  1. Avatar for joremen 81. joremen Lv 1 4 pts. 9,324
  2. Avatar for Crossed Sticks 82. Crossed Sticks Lv 1 3 pts. 9,313
  3. Avatar for altejoh 83. altejoh Lv 1 3 pts. 9,273
  4. Avatar for georg137 84. georg137 Lv 1 3 pts. 9,252
  5. Avatar for Atrus_Homeboy 85. Atrus_Homeboy Lv 1 3 pts. 9,224
  6. Avatar for Awilzman 86. Awilzman Lv 1 3 pts. 9,224
  7. Avatar for andrewtmaxwell 87. andrewtmaxwell Lv 1 3 pts. 9,182
  8. Avatar for NotJim99 88. NotJim99 Lv 1 2 pts. 9,176
  9. Avatar for teraflop 89. teraflop Lv 1 2 pts. 9,095
  10. Avatar for mrfu 90. mrfu Lv 1 2 pts. 9,088

Comments