Placeholder image of a protein
Icon representing a puzzle

1612: Unsolved De-novo Freestyle 139

Closed since about 7 years ago

Intermediate Overall Prediction

Summary

Created
December 20, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


PELEERLKTWLKIWYELMKKLLTWIAKVVSDEEFLKKVYKTMLEMMKEMWKILMEVLKKEEDLKKVIEIAIKFLIDLKRWMEDLKKKILS

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 11,121
  2. Avatar for Contenders 2. Contenders 78 pts. 11,068
  3. Avatar for Void Crushers 3. Void Crushers 60 pts. 10,974
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 45 pts. 10,907
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 33 pts. 10,850
  6. Avatar for Gargleblasters 6. Gargleblasters 24 pts. 10,720
  7. Avatar for Go Science 7. Go Science 17 pts. 10,672
  8. Avatar for Russian team 8. Russian team 12 pts. 10,643
  9. Avatar for Marvin's bunch 9. Marvin's bunch 8 pts. 10,627
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 6 pts. 10,508
  1. Avatar for alcor29 11. alcor29 Lv 1 13 pts. 10,821
  2. Avatar for andrewxc 12. andrewxc Lv 1 10 pts. 10,720
  3. Avatar for actiasluna 13. actiasluna Lv 1 7 pts. 10,716
  4. Avatar for ManVsYard 14. ManVsYard Lv 1 6 pts. 10,683
  5. Avatar for Vincera 15. Vincera Lv 1 4 pts. 10,677
  6. Avatar for isaksson 16. isaksson Lv 1 3 pts. 10,672
  7. Avatar for toshiue 17. toshiue Lv 1 2 pts. 10,670
  8. Avatar for Phyx 18. Phyx Lv 1 2 pts. 10,665
  9. Avatar for Bruno Kestemont 19. Bruno Kestemont Lv 1 1 pt. 10,665
  10. Avatar for fisherlr777 20. fisherlr777 Lv 1 1 pt. 10,663

Comments