Placeholder image of a protein
Icon representing a puzzle

1612: Unsolved De-novo Freestyle 139

Closed since about 7 years ago

Intermediate Overall Prediction

Summary

Created
December 20, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


PELEERLKTWLKIWYELMKKLLTWIAKVVSDEEFLKKVYKTMLEMMKEMWKILMEVLKKEEDLKKVIEIAIKFLIDLKRWMEDLKKKILS

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 11,121
  2. Avatar for Contenders 2. Contenders 78 pts. 11,068
  3. Avatar for Void Crushers 3. Void Crushers 60 pts. 10,974
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 45 pts. 10,907
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 33 pts. 10,850
  6. Avatar for Gargleblasters 6. Gargleblasters 24 pts. 10,720
  7. Avatar for Go Science 7. Go Science 17 pts. 10,672
  8. Avatar for Russian team 8. Russian team 12 pts. 10,643
  9. Avatar for Marvin's bunch 9. Marvin's bunch 8 pts. 10,627
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 6 pts. 10,508
  1. Avatar for Hollinas 21. Hollinas Lv 1 1 pt. 10,663
  2. Avatar for silent gene 22. silent gene Lv 1 1 pt. 10,660
  3. Avatar for Hellcat6 23. Hellcat6 Lv 1 1 pt. 10,635
  4. Avatar for Maerlyn138 24. Maerlyn138 Lv 1 1 pt. 10,634
  5. Avatar for jausmh 25. jausmh Lv 1 1 pt. 10,613
  6. Avatar for Mike Cassidy 26. Mike Cassidy Lv 1 1 pt. 10,605
  7. Avatar for Anfinsen_slept_here 27. Anfinsen_slept_here Lv 1 1 pt. 10,545
  8. Avatar for MicElephant 28. MicElephant Lv 1 1 pt. 10,444
  9. Avatar for alwen 29. alwen Lv 1 1 pt. 10,412
  10. Avatar for dbuske 30. dbuske Lv 1 1 pt. 10,215

Comments