1612: Unsolved De-novo Freestyle 139
Closed since over 7 years ago
Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction PredictionSummary
- Created
- December 20, 2018
- Expires
- Max points
- 100
The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!
Sequence:
PELEERLKTWLKIWYELMKKLLTWIAKVVSDEEFLKKVYKTMLEMMKEMWKILMEVLKKEEDLKKVIEIAIKFLIDLKRWMEDLKKKILS