Placeholder image of a protein
Icon representing a puzzle

1612: Unsolved De-novo Freestyle 139

Closed since over 7 years ago

Intermediate Overall Prediction

Summary


Created
December 20, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


PELEERLKTWLKIWYELMKKLLTWIAKVVSDEEFLKKVYKTMLEMMKEMWKILMEVLKKEEDLKKVIEIAIKFLIDLKRWMEDLKKKILS

Top groups


  1. Avatar for Beta Folders 100 pts. 11,121
  2. Avatar for Contenders 2. Contenders 78 pts. 11,068
  3. Avatar for Void Crushers 3. Void Crushers 60 pts. 10,974
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 45 pts. 10,907
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 33 pts. 10,850
  6. Avatar for Gargleblasters 6. Gargleblasters 24 pts. 10,720
  7. Avatar for Go Science 7. Go Science 17 pts. 10,672
  8. Avatar for Russian team 8. Russian team 12 pts. 10,643
  9. Avatar for Marvin's bunch 9. Marvin's bunch 8 pts. 10,627
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 6 pts. 10,508

  1. Avatar for Znaika 91. Znaika Lv 1 2 pts. 9,070
  2. Avatar for tela 92. tela Lv 1 2 pts. 9,000
  3. Avatar for ppp6 93. ppp6 Lv 1 2 pts. 8,992
  4. Avatar for Czim 94. Czim Lv 1 2 pts. 8,935
  5. Avatar for mirjamvandelft 95. mirjamvandelft Lv 1 2 pts. 8,927
  6. Avatar for Altercomp 96. Altercomp Lv 1 2 pts. 8,896
  7. Avatar for rinze 97. rinze Lv 1 1 pt. 8,795
  8. Avatar for momadoc 98. momadoc Lv 1 1 pt. 8,760
  9. Avatar for martinf 99. martinf Lv 1 1 pt. 8,716
  10. Avatar for charleswei 100. charleswei Lv 1 1 pt. 8,629

Comments