Placeholder image of a protein
Icon representing a puzzle

1612: Unsolved De-novo Freestyle 139

Closed since over 7 years ago

Intermediate Overall Prediction

Summary


Created
December 20, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


PELEERLKTWLKIWYELMKKLLTWIAKVVSDEEFLKKVYKTMLEMMKEMWKILMEVLKKEEDLKKVIEIAIKFLIDLKRWMEDLKKKILS

Top groups


  1. Avatar for Beta Folders 100 pts. 11,121
  2. Avatar for Contenders 2. Contenders 78 pts. 11,068
  3. Avatar for Void Crushers 3. Void Crushers 60 pts. 10,974
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 45 pts. 10,907
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 33 pts. 10,850
  6. Avatar for Gargleblasters 6. Gargleblasters 24 pts. 10,720
  7. Avatar for Go Science 7. Go Science 17 pts. 10,672
  8. Avatar for Russian team 8. Russian team 12 pts. 10,643
  9. Avatar for Marvin's bunch 9. Marvin's bunch 8 pts. 10,627
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 6 pts. 10,508

  1. Avatar for petetrig 111. petetrig Lv 1 1 pt. 8,299
  2. Avatar for Bletchley Park 112. Bletchley Park Lv 1 1 pt. 8,278
  3. Avatar for FrankytheBrain 113. FrankytheBrain Lv 1 1 pt. 8,264
  4. Avatar for Jesse Pinkman 114. Jesse Pinkman Lv 1 1 pt. 8,261
  5. Avatar for ourtown 115. ourtown Lv 1 1 pt. 8,256
  6. Avatar for Marvelz 116. Marvelz Lv 1 1 pt. 8,247
  7. Avatar for Lyshi2018 117. Lyshi2018 Lv 1 1 pt. 8,208
  8. Avatar for Cyberkashi 118. Cyberkashi Lv 1 1 pt. 8,055
  9. Avatar for molleke 119. molleke Lv 1 1 pt. 7,362
  10. Avatar for Knoblerine 120. Knoblerine Lv 1 1 pt. 7,321

Comments