Placeholder image of a protein
Icon representing a puzzle

1612: Unsolved De-novo Freestyle 139

Closed since over 7 years ago

Intermediate Overall Prediction

Summary


Created
December 20, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


PELEERLKTWLKIWYELMKKLLTWIAKVVSDEEFLKKVYKTMLEMMKEMWKILMEVLKKEEDLKKVIEIAIKFLIDLKRWMEDLKKKILS

Top groups


  1. Avatar for Beta Folders 100 pts. 11,121
  2. Avatar for Contenders 2. Contenders 78 pts. 11,068
  3. Avatar for Void Crushers 3. Void Crushers 60 pts. 10,974
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 45 pts. 10,907
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 33 pts. 10,850
  6. Avatar for Gargleblasters 6. Gargleblasters 24 pts. 10,720
  7. Avatar for Go Science 7. Go Science 17 pts. 10,672
  8. Avatar for Russian team 8. Russian team 12 pts. 10,643
  9. Avatar for Marvin's bunch 9. Marvin's bunch 8 pts. 10,627
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 6 pts. 10,508

  1. Avatar for SouperGenious 131. SouperGenious Lv 1 1 pt. 6,502
  2. Avatar for SiPot2018 132. SiPot2018 Lv 1 1 pt. 6,492
  3. Avatar for ugugu 133. ugugu Lv 1 1 pt. 6,334
  4. Avatar for borattt 134. borattt Lv 1 1 pt. 6,218
  5. Avatar for RootBeerSwordsman 135. RootBeerSwordsman Lv 1 1 pt. 6,014
  6. Avatar for 01010011111 136. 01010011111 Lv 1 1 pt. 5,829
  7. Avatar for kyoota 137. kyoota Lv 1 1 pt. 5,456
  8. Avatar for sydlg19 138. sydlg19 Lv 1 1 pt. 5,224
  9. Avatar for jdmclure 139. jdmclure Lv 1 1 pt. 5,193
  10. Avatar for Phyx 140. Phyx Lv 1 1 pt. 5,110

Comments