Placeholder image of a protein
Icon representing a puzzle

1612: Unsolved De-novo Freestyle 139

Closed since over 7 years ago

Intermediate Overall Prediction

Summary


Created
December 20, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


PELEERLKTWLKIWYELMKKLLTWIAKVVSDEEFLKKVYKTMLEMMKEMWKILMEVLKKEEDLKKVIEIAIKFLIDLKRWMEDLKKKILS

Top groups


  1. Avatar for Beta Folders 100 pts. 11,121
  2. Avatar for Contenders 2. Contenders 78 pts. 11,068
  3. Avatar for Void Crushers 3. Void Crushers 60 pts. 10,974
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 45 pts. 10,907
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 33 pts. 10,850
  6. Avatar for Gargleblasters 6. Gargleblasters 24 pts. 10,720
  7. Avatar for Go Science 7. Go Science 17 pts. 10,672
  8. Avatar for Russian team 8. Russian team 12 pts. 10,643
  9. Avatar for Marvin's bunch 9. Marvin's bunch 8 pts. 10,627
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 6 pts. 10,508

  1. Avatar for Wojcimierz 21. Wojcimierz Lv 1 52 pts. 10,637
  2. Avatar for MurloW 22. MurloW Lv 1 50 pts. 10,632
  3. Avatar for frood66 23. frood66 Lv 1 48 pts. 10,627
  4. Avatar for jobo0502 24. jobo0502 Lv 1 46 pts. 10,569
  5. Avatar for spvincent 25. spvincent Lv 1 45 pts. 10,535
  6. Avatar for Anfinsen_slept_here 26. Anfinsen_slept_here Lv 1 43 pts. 10,516
  7. Avatar for Hiro Protagonist 27. Hiro Protagonist Lv 1 41 pts. 10,508
  8. Avatar for TastyMunchies 28. TastyMunchies Lv 1 40 pts. 10,505
  9. Avatar for NinjaGreg 29. NinjaGreg Lv 1 38 pts. 10,505
  10. Avatar for Bruno Kestemont 30. Bruno Kestemont Lv 1 37 pts. 10,490

Comments