Placeholder image of a protein
Icon representing a puzzle

1612: Unsolved De-novo Freestyle 139

Closed since over 7 years ago

Intermediate Overall Prediction

Summary


Created
December 20, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


PELEERLKTWLKIWYELMKKLLTWIAKVVSDEEFLKKVYKTMLEMMKEMWKILMEVLKKEEDLKKVIEIAIKFLIDLKRWMEDLKKKILS

Top groups


  1. Avatar for Beta Folders 100 pts. 11,121
  2. Avatar for Contenders 2. Contenders 78 pts. 11,068
  3. Avatar for Void Crushers 3. Void Crushers 60 pts. 10,974
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 45 pts. 10,907
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 33 pts. 10,850
  6. Avatar for Gargleblasters 6. Gargleblasters 24 pts. 10,720
  7. Avatar for Go Science 7. Go Science 17 pts. 10,672
  8. Avatar for Russian team 8. Russian team 12 pts. 10,643
  9. Avatar for Marvin's bunch 9. Marvin's bunch 8 pts. 10,627
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 6 pts. 10,508

  1. Avatar for Hellcat6 61. Hellcat6 Lv 1 10 pts. 10,023
  2. Avatar for Bautho 62. Bautho Lv 1 9 pts. 9,974
  3. Avatar for spdenne 63. spdenne Lv 1 9 pts. 9,938
  4. Avatar for mitarcher 64. mitarcher Lv 1 9 pts. 9,883
  5. Avatar for jausmh 65. jausmh Lv 1 8 pts. 9,879
  6. Avatar for ViJay7019 66. ViJay7019 Lv 1 8 pts. 9,807
  7. Avatar for uihcv 67. uihcv Lv 1 7 pts. 9,803
  8. Avatar for KingLear 68. KingLear Lv 1 7 pts. 9,771
  9. Avatar for dnpw1 69. dnpw1 Lv 1 7 pts. 9,761
  10. Avatar for micheldeweerd 70. micheldeweerd Lv 1 6 pts. 9,732

Comments