Placeholder image of a protein
Icon representing a puzzle

1612: Unsolved De-novo Freestyle 139

Closed since over 7 years ago

Intermediate Overall Prediction

Summary


Created
December 20, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


PELEERLKTWLKIWYELMKKLLTWIAKVVSDEEFLKKVYKTMLEMMKEMWKILMEVLKKEEDLKKVIEIAIKFLIDLKRWMEDLKKKILS

Top groups


  1. Avatar for Beta Folders 100 pts. 11,121
  2. Avatar for Contenders 2. Contenders 78 pts. 11,068
  3. Avatar for Void Crushers 3. Void Crushers 60 pts. 10,974
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 45 pts. 10,907
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 33 pts. 10,850
  6. Avatar for Gargleblasters 6. Gargleblasters 24 pts. 10,720
  7. Avatar for Go Science 7. Go Science 17 pts. 10,672
  8. Avatar for Russian team 8. Russian team 12 pts. 10,643
  9. Avatar for Marvin's bunch 9. Marvin's bunch 8 pts. 10,627
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 6 pts. 10,508

  1. Avatar for Mortality 71. Mortality Lv 1 6 pts. 9,724
  2. Avatar for YeshuaLives 72. YeshuaLives Lv 1 6 pts. 9,688
  3. Avatar for rabamino12358 73. rabamino12358 Lv 1 5 pts. 9,678
  4. Avatar for TePie 74. TePie Lv 1 5 pts. 9,532
  5. Avatar for Vincera 75. Vincera Lv 1 5 pts. 9,520
  6. Avatar for Dhalion 76. Dhalion Lv 1 5 pts. 9,454
  7. Avatar for alcor29 77. alcor29 Lv 1 4 pts. 9,431
  8. Avatar for Rastamasta 78. Rastamasta Lv 1 4 pts. 9,406
  9. Avatar for fisherlr777 79. fisherlr777 Lv 1 4 pts. 9,403
  10. Avatar for Arne Heessels 80. Arne Heessels Lv 1 4 pts. 9,367

Comments