Placeholder image of a protein
Icon representing a puzzle

1614: Revisiting Puzzle 91: Virus Protein

Closed since over 7 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
December 27, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found on the surface of bacteriophage fd, a virus that infects E. coli. It is responsible for penetrating the cell membrane of the host bacteria, allowing virus to enter the cell. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPIGLAIPENAAAH

Top groups


  1. Avatar for Hold My Beer 11. Hold My Beer 2 pts. 9,529
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 9,205
  3. Avatar for freefolder 13. freefolder 1 pt. 9,166
  4. Avatar for FoldIt@Poland 14. FoldIt@Poland 1 pt. 8,981
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 8,723
  6. Avatar for Dutch Power Cows 16. Dutch Power Cows 1 pt. 8,501
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 8,481
  8. Avatar for Rechenkraft.net 18. Rechenkraft.net 1 pt. 8,469

  1. Avatar for matosfran
    1. matosfran Lv 1
    100 pts. 10,462
  2. Avatar for actiasluna 2. actiasluna Lv 1 97 pts. 10,441
  3. Avatar for fiendish_ghoul 3. fiendish_ghoul Lv 1 94 pts. 10,430
  4. Avatar for Idiotboy 4. Idiotboy Lv 1 91 pts. 10,422
  5. Avatar for LociOiling 5. LociOiling Lv 1 88 pts. 10,418
  6. Avatar for Timo van der Laan 6. Timo van der Laan Lv 1 85 pts. 10,397
  7. Avatar for NinjaGreg 7. NinjaGreg Lv 1 82 pts. 10,397
  8. Avatar for retiredmichael 8. retiredmichael Lv 1 79 pts. 10,376
  9. Avatar for tyler0911 9. tyler0911 Lv 1 77 pts. 10,365
  10. Avatar for frood66 10. frood66 Lv 1 74 pts. 10,326

Comments