Placeholder image of a protein
Icon representing a puzzle

1614: Revisiting Puzzle 91: Virus Protein

Closed since over 7 years ago

Novice Overall Prediction

Summary


Created
December 27, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found on the surface of bacteriophage fd, a virus that infects E. coli. It is responsible for penetrating the cell membrane of the host bacteria, allowing virus to enter the cell. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPIGLAIPENAAAH

Top groups


  1. Avatar for Beta Folders 100 pts. 10,497
  2. Avatar for Gargleblasters 2. Gargleblasters 74 pts. 10,450
  3. Avatar for Void Crushers 3. Void Crushers 54 pts. 10,397
  4. Avatar for Go Science 4. Go Science 38 pts. 10,397
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 27 pts. 10,378
  6. Avatar for Marvin's bunch 6. Marvin's bunch 18 pts. 10,326
  7. Avatar for Contenders 7. Contenders 12 pts. 10,242
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 8 pts. 10,207
  9. Avatar for Russian team 9. Russian team 5 pts. 10,193
  10. Avatar for Kotocycle 10. Kotocycle 3 pts. 10,050

  1. Avatar for matosfran
    1. matosfran Lv 1
    100 pts. 10,462
  2. Avatar for actiasluna 2. actiasluna Lv 1 97 pts. 10,441
  3. Avatar for fiendish_ghoul 3. fiendish_ghoul Lv 1 94 pts. 10,430
  4. Avatar for Idiotboy 4. Idiotboy Lv 1 91 pts. 10,422
  5. Avatar for LociOiling 5. LociOiling Lv 1 88 pts. 10,418
  6. Avatar for Timo van der Laan 6. Timo van der Laan Lv 1 85 pts. 10,397
  7. Avatar for NinjaGreg 7. NinjaGreg Lv 1 82 pts. 10,397
  8. Avatar for retiredmichael 8. retiredmichael Lv 1 79 pts. 10,376
  9. Avatar for tyler0911 9. tyler0911 Lv 1 77 pts. 10,365
  10. Avatar for frood66 10. frood66 Lv 1 74 pts. 10,326

Comments