Placeholder image of a protein
Icon representing a puzzle

1614: Revisiting Puzzle 91: Virus Protein

Closed since over 7 years ago

Novice Overall Prediction

Summary


Created
December 27, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found on the surface of bacteriophage fd, a virus that infects E. coli. It is responsible for penetrating the cell membrane of the host bacteria, allowing virus to enter the cell. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPIGLAIPENAAAH

Top groups


  1. Avatar for Beta Folders 100 pts. 10,497
  2. Avatar for Gargleblasters 2. Gargleblasters 74 pts. 10,450
  3. Avatar for Void Crushers 3. Void Crushers 54 pts. 10,397
  4. Avatar for Go Science 4. Go Science 38 pts. 10,397
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 27 pts. 10,378
  6. Avatar for Marvin's bunch 6. Marvin's bunch 18 pts. 10,326
  7. Avatar for Contenders 7. Contenders 12 pts. 10,242
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 8 pts. 10,207
  9. Avatar for Russian team 9. Russian team 5 pts. 10,193
  10. Avatar for Kotocycle 10. Kotocycle 3 pts. 10,050

  1. Avatar for Maerlyn138 51. Maerlyn138 Lv 1 14 pts. 9,812
  2. Avatar for Crossed Sticks 52. Crossed Sticks Lv 1 13 pts. 9,809
  3. Avatar for christioanchauvin 53. christioanchauvin Lv 1 12 pts. 9,782
  4. Avatar for heather-1 54. heather-1 Lv 1 12 pts. 9,708
  5. Avatar for isaksson 55. isaksson Lv 1 11 pts. 9,708
  6. Avatar for rezaefar 56. rezaefar Lv 1 11 pts. 9,589
  7. Avatar for WBarme1234 57. WBarme1234 Lv 1 10 pts. 9,573
  8. Avatar for NR22 58. NR22 Lv 1 10 pts. 9,563
  9. Avatar for jamiexq 59. jamiexq Lv 1 9 pts. 9,542
  10. Avatar for alwen 60. alwen Lv 1 9 pts. 9,539

Comments