Placeholder image of a protein
Icon representing a puzzle

1614: Revisiting Puzzle 91: Virus Protein

Closed since over 7 years ago

Novice Overall Prediction

Summary


Created
December 27, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found on the surface of bacteriophage fd, a virus that infects E. coli. It is responsible for penetrating the cell membrane of the host bacteria, allowing virus to enter the cell. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPIGLAIPENAAAH

Top groups


  1. Avatar for Beta Folders 100 pts. 10,497
  2. Avatar for Gargleblasters 2. Gargleblasters 74 pts. 10,450
  3. Avatar for Void Crushers 3. Void Crushers 54 pts. 10,397
  4. Avatar for Go Science 4. Go Science 38 pts. 10,397
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 27 pts. 10,378
  6. Avatar for Marvin's bunch 6. Marvin's bunch 18 pts. 10,326
  7. Avatar for Contenders 7. Contenders 12 pts. 10,242
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 8 pts. 10,207
  9. Avatar for Russian team 9. Russian team 5 pts. 10,193
  10. Avatar for Kotocycle 10. Kotocycle 3 pts. 10,050

  1. Avatar for Aminal88 61. Aminal88 Lv 1 8 pts. 9,529
  2. Avatar for Wojcimierz 62. Wojcimierz Lv 1 8 pts. 9,509
  3. Avatar for Merf 63. Merf Lv 1 7 pts. 9,502
  4. Avatar for Psych0Active 64. Psych0Active Lv 1 7 pts. 9,455
  5. Avatar for scottwuzhear 65. scottwuzhear Lv 1 7 pts. 9,444
  6. Avatar for dbuske 66. dbuske Lv 1 6 pts. 9,385
  7. Avatar for benrh 67. benrh Lv 1 6 pts. 9,348
  8. Avatar for Bautho 68. Bautho Lv 1 6 pts. 9,336
  9. Avatar for cobaltteal 69. cobaltteal Lv 1 5 pts. 9,320
  10. Avatar for Alistair69 70. Alistair69 Lv 1 5 pts. 9,263

Comments