Placeholder image of a protein
Icon representing a puzzle

1614: Revisiting Puzzle 91: Virus Protein

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
December 27, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found on the surface of bacteriophage fd, a virus that infects E. coli. It is responsible for penetrating the cell membrane of the host bacteria, allowing virus to enter the cell. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPIGLAIPENAAAH

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,497
  2. Avatar for Gargleblasters 2. Gargleblasters 74 pts. 10,450
  3. Avatar for Void Crushers 3. Void Crushers 54 pts. 10,397
  4. Avatar for Go Science 4. Go Science 38 pts. 10,397
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 27 pts. 10,378
  6. Avatar for Marvin's bunch 6. Marvin's bunch 18 pts. 10,326
  7. Avatar for Contenders 7. Contenders 12 pts. 10,242
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 8 pts. 10,207
  9. Avatar for Russian team 9. Russian team 5 pts. 10,193
  10. Avatar for Kotocycle 10. Kotocycle 3 pts. 10,050
  1. Avatar for robgee 31. robgee Lv 1 33 pts. 10,110
  2. Avatar for Vinara 32. Vinara Lv 1 32 pts. 10,109
  3. Avatar for YeshuaLives 33. YeshuaLives Lv 1 31 pts. 10,077
  4. Avatar for fpc 34. fpc Lv 1 29 pts. 10,063
  5. Avatar for silent gene 35. silent gene Lv 1 28 pts. 10,062
  6. Avatar for pvc78 36. pvc78 Lv 1 27 pts. 10,062
  7. Avatar for Ikuso 37. Ikuso Lv 1 26 pts. 10,050
  8. Avatar for katling 38. katling Lv 1 25 pts. 10,034
  9. Avatar for Satina 39. Satina Lv 1 24 pts. 10,023
  10. Avatar for Deleted player 40. Deleted player pts. 10,000

Comments