Placeholder image of a protein
Icon representing a puzzle

1614: Revisiting Puzzle 91: Virus Protein

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
December 27, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found on the surface of bacteriophage fd, a virus that infects E. coli. It is responsible for penetrating the cell membrane of the host bacteria, allowing virus to enter the cell. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPIGLAIPENAAAH

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,497
  2. Avatar for Gargleblasters 2. Gargleblasters 74 pts. 10,450
  3. Avatar for Void Crushers 3. Void Crushers 54 pts. 10,397
  4. Avatar for Go Science 4. Go Science 38 pts. 10,397
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 27 pts. 10,378
  6. Avatar for Marvin's bunch 6. Marvin's bunch 18 pts. 10,326
  7. Avatar for Contenders 7. Contenders 12 pts. 10,242
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 8 pts. 10,207
  9. Avatar for Russian team 9. Russian team 5 pts. 10,193
  10. Avatar for Kotocycle 10. Kotocycle 3 pts. 10,050
  1. Avatar for Squirrely 81. Squirrely Lv 1 3 pts. 9,055
  2. Avatar for ManVsYard 82. ManVsYard Lv 1 3 pts. 9,046
  3. Avatar for molleke 83. molleke Lv 1 2 pts. 9,040
  4. Avatar for pfirth 84. pfirth Lv 1 2 pts. 9,016
  5. Avatar for oureion 85. oureion Lv 1 2 pts. 8,981
  6. Avatar for jausmh 86. jausmh Lv 1 2 pts. 8,936
  7. Avatar for ivalnic 87. ivalnic Lv 1 2 pts. 8,926
  8. Avatar for RootBeerSwordsman 88. RootBeerSwordsman Lv 1 2 pts. 8,908
  9. Avatar for morris3190 89. morris3190 Lv 1 2 pts. 8,875
  10. Avatar for manu8170 90. manu8170 Lv 1 2 pts. 8,875

Comments