Placeholder image of a protein
Icon representing a puzzle

1615: Unsolved De-novo Freestyle 140

Closed since about 7 years ago

Intermediate

Summary

Created
December 27, 2018
Expires
Max points
100
Description

Note: This puzzle was posted erroneously with the wrong setup. The puzzle was closed early, and has been reposted with the correct setup as Puzzle 1615b.



The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PDEKDMEDKMRKVLKDLQDTTKDEELDRLMKELLKKMYEWLKKRKDKELFKKMLKLLKEVLDELKKDRDKRRLRELIDRMLKKIKKEVD

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,191
  2. Avatar for Go Science 2. Go Science 41 pts. 9,006
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 14 pts. 8,914
  4. Avatar for Dutch Power Cows 4. Dutch Power Cows 4 pts. 8,263
  5. Avatar for Beta Folders 5. Beta Folders 1 pt. 7,676
  6. Avatar for Contenders 6. Contenders 1 pt. 3,869
  7. Avatar for Gargleblasters 7. Gargleblasters 1 pt. 3,869
  1. Avatar for mrfu 11. mrfu Lv 1 1 pt. 8,263
  2. Avatar for LociOiling 12. LociOiling Lv 1 1 pt. 7,676
  3. Avatar for Susume 13. Susume Lv 1 1 pt. 3,869
  4. Avatar for crpainter 14. crpainter Lv 1 1 pt. 3,869
  5. Avatar for Blipperman 15. Blipperman Lv 1 1 pt. 3,869
  6. Avatar for dcrwheeler 16. dcrwheeler Lv 1 1 pt. 3,869
  7. Avatar for bkoep 17. bkoep Lv 1 1 pt. 3,869

Comments