Placeholder image of a protein
Icon representing a puzzle

1615: Unsolved De-novo Freestyle 140

Closed since over 7 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate

Summary


Created
December 27, 2018
Expires
Max points
100
Description

Note: This puzzle was posted erroneously with the wrong setup. The puzzle was closed early, and has been reposted with the correct setup as Puzzle 1615b.



The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PDEKDMEDKMRKVLKDLQDTTKDEELDRLMKELLKKMYEWLKKRKDKELFKKMLKLLKEVLDELKKDRDKRRLRELIDRMLKKIKKEVD

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,191
  2. Avatar for Go Science 2. Go Science 41 pts. 9,006
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 14 pts. 8,914
  4. Avatar for Dutch Power Cows 4. Dutch Power Cows 4 pts. 8,263
  5. Avatar for Beta Folders 5. Beta Folders 1 pt. 7,676
  6. Avatar for Contenders 6. Contenders 1 pt. 3,869
  7. Avatar for Gargleblasters 7. Gargleblasters 1 pt. 3,869

  1. Avatar for Heinermann
    1. Heinermann Lv 1
    100 pts. 9,191
  2. Avatar for Vincera 3. Vincera Lv 1 52 pts. 8,914
  3. Avatar for sydlg19 4. sydlg19 Lv 1 36 pts. 8,895
  4. Avatar for fisherlr777 5. fisherlr777 Lv 1 24 pts. 8,711
  5. Avatar for TastyMunchies 6. TastyMunchies Lv 1 16 pts. 8,666
  6. Avatar for Dhalion 7. Dhalion Lv 1 10 pts. 8,566
  7. Avatar for johnmitch 8. johnmitch Lv 1 6 pts. 8,549
  8. Avatar for Bautho 9. Bautho Lv 1 4 pts. 8,527
  9. Avatar for Galaxie 10. Galaxie Lv 1 2 pts. 8,272

Comments