Bautho Lv 1
ETVTSCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCTGTWVPIGLAIPENAAAH
Closed since over 7 years ago
IntermediateNote: This puzzle was posted erroneously with the wrong setup. The puzzle was closed early, and has been reposted with the correct setup as Puzzle 1615b.
The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!
Sequence:
ETVTSCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCTGTWVPIGLAIPENAAAH
Looks like you accidentally re-posted puzzle 1614 (revisiting) instead of the denovo.
Sorry for the mix up! This puzzle has been closed. See the correct Puzzle 1615 here.