Placeholder image of a protein
Icon representing a puzzle

1615b: Unsolved De-novo Freestyle 140

Closed since about 7 years ago

Intermediate Overall Prediction

Summary

Created
December 28, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PDEKDMEDKMRKVLKDLQDTTKDEELDRLMKELLKKMYEWLKKRKDKELFKKMLKLLKEVLDELKKDRDKRRLRELIDRMLKKIKKEVD

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 1 pt. 10,485
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 10,049
  3. Avatar for FoldIt@Poland 13. FoldIt@Poland 1 pt. 9,557
  4. Avatar for Italiani Al Lavoro 14. Italiani Al Lavoro 1 pt. 0
  5. Avatar for Dutch Power Cows 15. Dutch Power Cows 1 pt. 0
  1. Avatar for robgee 11. robgee Lv 1 72 pts. 11,147
  2. Avatar for Galaxie 12. Galaxie Lv 1 69 pts. 11,107
  3. Avatar for isaksson 13. isaksson Lv 1 67 pts. 11,104
  4. Avatar for Blipperman 14. Blipperman Lv 1 65 pts. 11,082
  5. Avatar for actiasluna 15. actiasluna Lv 1 62 pts. 11,079
  6. Avatar for spmm 16. spmm Lv 1 60 pts. 11,062
  7. Avatar for dcrwheeler 17. dcrwheeler Lv 1 58 pts. 11,057
  8. Avatar for Timo van der Laan 18. Timo van der Laan Lv 1 56 pts. 11,054
  9. Avatar for nicobul 19. nicobul Lv 1 54 pts. 11,053
  10. Avatar for phi16 20. phi16 Lv 1 52 pts. 11,052

Comments