Placeholder image of a protein
Icon representing a puzzle

1615b: Unsolved De-novo Freestyle 140

Closed since about 7 years ago

Intermediate Overall Prediction

Summary

Created
December 28, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PDEKDMEDKMRKVLKDLQDTTKDEELDRLMKELLKKMYEWLKKRKDKELFKKMLKLLKEVLDELKKDRDKRRLRELIDRMLKKIKKEVD

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 11,419
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 70 pts. 11,305
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 47 pts. 11,278
  4. Avatar for Contenders 4. Contenders 30 pts. 11,173
  5. Avatar for Go Science 5. Go Science 19 pts. 11,142
  6. Avatar for Gargleblasters 6. Gargleblasters 11 pts. 11,118
  7. Avatar for Void Crushers 7. Void Crushers 7 pts. 11,062
  8. Avatar for Russian team 8. Russian team 4 pts. 11,045
  9. Avatar for Marvin's bunch 9. Marvin's bunch 2 pts. 11,022
  10. Avatar for Hold My Beer 10. Hold My Beer 1 pt. 10,952
  1. Avatar for robgee 11. robgee Lv 1 72 pts. 11,147
  2. Avatar for Galaxie 12. Galaxie Lv 1 69 pts. 11,107
  3. Avatar for isaksson 13. isaksson Lv 1 67 pts. 11,104
  4. Avatar for Blipperman 14. Blipperman Lv 1 65 pts. 11,082
  5. Avatar for actiasluna 15. actiasluna Lv 1 62 pts. 11,079
  6. Avatar for spmm 16. spmm Lv 1 60 pts. 11,062
  7. Avatar for dcrwheeler 17. dcrwheeler Lv 1 58 pts. 11,057
  8. Avatar for Timo van der Laan 18. Timo van der Laan Lv 1 56 pts. 11,054
  9. Avatar for nicobul 19. nicobul Lv 1 54 pts. 11,053
  10. Avatar for phi16 20. phi16 Lv 1 52 pts. 11,052

Comments