Placeholder image of a protein
Icon representing a puzzle

1615b: Unsolved De-novo Freestyle 140

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
December 28, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PDEKDMEDKMRKVLKDLQDTTKDEELDRLMKELLKKMYEWLKKRKDKELFKKMLKLLKEVLDELKKDRDKRRLRELIDRMLKKIKKEVD

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 1 pt. 10,485
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 10,049
  3. Avatar for FoldIt@Poland 13. FoldIt@Poland 1 pt. 9,557
  4. Avatar for Italiani Al Lavoro 14. Italiani Al Lavoro 1 pt. 0
  5. Avatar for Dutch Power Cows 15. Dutch Power Cows 1 pt. 0
  1. Avatar for manu8170 51. manu8170 Lv 1 14 pts. 10,755
  2. Avatar for Bruno Kestemont 52. Bruno Kestemont Lv 1 14 pts. 10,743
  3. Avatar for katling 53. katling Lv 1 13 pts. 10,699
  4. Avatar for altejoh 54. altejoh Lv 1 12 pts. 10,690
  5. Avatar for orily1337 55. orily1337 Lv 1 12 pts. 10,661
  6. Avatar for heather-1 56. heather-1 Lv 1 11 pts. 10,626
  7. Avatar for YeshuaLives 57. YeshuaLives Lv 1 11 pts. 10,593
  8. Avatar for Threeoak 58. Threeoak Lv 1 10 pts. 10,556
  9. Avatar for Marvelz 59. Marvelz Lv 1 10 pts. 10,543
  10. Avatar for pfirth 60. pfirth Lv 1 9 pts. 10,518

Comments