Placeholder image of a protein
Icon representing a puzzle

1615b: Unsolved De-novo Freestyle 140

Closed since about 7 years ago

Intermediate Overall Prediction

Summary


Created
December 28, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PDEKDMEDKMRKVLKDLQDTTKDEELDRLMKELLKKMYEWLKKRKDKELFKKMLKLLKEVLDELKKDRDKRRLRELIDRMLKKIKKEVD

Top groups


  1. Avatar for Beta Folders 100 pts. 11,419
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 70 pts. 11,305
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 47 pts. 11,278
  4. Avatar for Contenders 4. Contenders 30 pts. 11,173
  5. Avatar for Go Science 5. Go Science 19 pts. 11,142
  6. Avatar for Gargleblasters 6. Gargleblasters 11 pts. 11,118
  7. Avatar for Void Crushers 7. Void Crushers 7 pts. 11,062
  8. Avatar for Russian team 8. Russian team 4 pts. 11,045
  9. Avatar for Marvin's bunch 9. Marvin's bunch 2 pts. 11,022
  10. Avatar for Hold My Beer 10. Hold My Beer 1 pt. 10,952

  1. Avatar for manu8170 51. manu8170 Lv 1 14 pts. 10,755
  2. Avatar for Bruno Kestemont 52. Bruno Kestemont Lv 1 14 pts. 10,743
  3. Avatar for katling 53. katling Lv 1 13 pts. 10,699
  4. Avatar for altejoh 54. altejoh Lv 1 12 pts. 10,690
  5. Avatar for orily1337 55. orily1337 Lv 1 12 pts. 10,661
  6. Avatar for heather-1 56. heather-1 Lv 1 11 pts. 10,626
  7. Avatar for YeshuaLives 57. YeshuaLives Lv 1 11 pts. 10,593
  8. Avatar for Threeoak 58. Threeoak Lv 1 10 pts. 10,556
  9. Avatar for Marvelz 59. Marvelz Lv 1 10 pts. 10,543
  10. Avatar for pfirth 60. pfirth Lv 1 9 pts. 10,518

Comments