Placeholder image of a protein
Icon representing a puzzle

1620: Revisiting Puzzle 93: Spider Toxin

Closed since over 7 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
January 08, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups


  1. Avatar for Hold My Beer 11. Hold My Beer 2 pts. 9,343
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 9,114
  3. Avatar for FoldIt@Poland 13. FoldIt@Poland 1 pt. 8,487
  4. Avatar for DW 2020 14. DW 2020 1 pt. 8,464
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 8,424
  6. Avatar for Team South Africa 16. Team South Africa 1 pt. 7,719
  7. Avatar for freefolder 17. freefolder 1 pt. 7,447
  8. Avatar for Rechenkraft.net 18. Rechenkraft.net 1 pt. 6,938
  9. Avatar for Deleted group 19. Deleted group pts. 6,805

  1. Avatar for pvc78 41. pvc78 Lv 1 26 pts. 9,508
  2. Avatar for nicobul 42. nicobul Lv 1 25 pts. 9,464
  3. Avatar for Norrjane 43. Norrjane Lv 1 24 pts. 9,460
  4. Avatar for DoctorSockrates 44. DoctorSockrates Lv 1 23 pts. 9,453
  5. Avatar for heather-1 45. heather-1 Lv 1 22 pts. 9,448
  6. Avatar for diamonddays 46. diamonddays Lv 1 21 pts. 9,446
  7. Avatar for Mark- 47. Mark- Lv 1 20 pts. 9,446
  8. Avatar for Vinara 48. Vinara Lv 1 20 pts. 9,440
  9. Avatar for toshiue 49. toshiue Lv 1 19 pts. 9,435
  10. Avatar for guineapig 50. guineapig Lv 1 18 pts. 9,429

Comments